Ending to Lamb to the salughter

1 year after Mrs. Maloney had murdered her husband. The cell of Mrs. Maloney was dark and cold covered with cobwebs and dust from the years of the past. Mrs. Maloney sat on her bed awaiting the first light of dawn through the small window of her cell. She shared this cell with another called Fran. Fran had been put into to jail for stealing two vans and à ¯Ã‚ ¿Ã‚ ½5,000,000. Suddenly the bell for breakfast rung. â€Å"Come on Fran wake up! Come on!† Fran sat up on here bed rubbing her eyes. â€Å"What's the time?† asked Fran, in her cockney slang voice. â€Å"Half eight exactly† replied Mrs. Maloney. â€Å"Here you go girls. The usual.† said the guard. â€Å"Don't forget what day it is today Fran!† as the guard shouted back to their cell. â€Å"I can't wait until I am out of this place for good. I have promised myself that I will never steal again.† â€Å"Good on you Fran. I am so pleased you are nearly a free women. Is there anyone you are expecting to see you?† â€Å"Yes. Now you mention it I wonder if Tony will be here this afternoon.† â€Å"Who is Tony?† â€Å"My husband. Well, if he will forgive me for stealing two vans and à ¯Ã‚ ¿Ã‚ ½5,000,000.† â€Å"I'm sure he will. Anyway let's dig in. We don't want to have cold food.† When Mrs. Maloney and Fran had finally eaten all of their breakfast, Fran started to pack and get ready for the outside world. As she was packing her mind was racing. What will the world look like after ten years in prison? Will it have changed? A few hours later Fran was called to go to the checking out desk. Fran had to fill out several forms and tell them where exactly she was planning to stay and a telephone number she had to call once in the morning and once in the evening. Fran started to get extremely excited. When Fran got outside there was Tony in a brand new silver Peugeot. Fran was so happy to see him after all these years. She thought he had forgotten her, but no she was wrong. Meanwhile Mrs. Maloney was to see her new cell mate. She was starting to get nervous. â€Å"Here is your cell Sheila. Now dinner will be in a few hours and there will be a bell rung. I am sure you two will get on well together.† Said the guard as he pointed towards Mrs. Maloney's cell. There was silence for some time and neither of the spoke. After some time Mrs. Maloney spoke â€Å"Hello, I am Sandra. Why are you here?† â€Å"I am here because I murdered my husband. I kept it a secret at first, but I felt as if I was haunted. I then owned up because I couldn't stop myself from going mad.† â€Å"Hey, that is what happened to me. I feel so much better here.† There was a long discussion for several hours and then the dinner bell rung. â€Å"Dinner time.† Said Mrs. Maloney. â€Å"Great I am starving. I thought that jail would be horrid and I would have this horrible cell mate, but I think you are the nicest person I have ever met.†

Lowering the Drinking Age to 18

It’s your 18th birthday and your finally a legal adult. Immediately you can smoke cigarettes, vote, be a jury member, even join the military and fight for your country. But don’t think about a having a beer at your going away party the night before you depart for the Middle East. No, you will have to wait until your 21. As an American citizens we are given many responsibilities at the age of 18. One of them not being the ability to consume alcohol. So I believe that at the age of 18 should come the responsibility of legally partaking of alcohol. If we are considered adults and expected to act like one at the age of 18, it isn’t right to restrict us to a drinking age of 21. At 18 you can get married, vote, pay taxes, take out loans or risk your life as a member of the U. S. military. But the law in our country says that no alcoholic beverages may be sold to anyone until the age of 21. Who says that 21 is the magical age that makes one intelligent and mature enough to consume alcohol. Sure some adults abuse alcohol and some teenagers would be able to drink responsibly. While 21 may be the legal drinking age in the U. S. no scientific evidence exists proving this is the age at which young people can safely begin drinking alcohol. (Bryan Knowles). By lowering the drinking age it would take away some of the temptation involved with alcohol. It’s not as much fun when its allowed! The most common reason for underage drinking is because alcohol is seen as â€Å"the forbidden fruit. In a study by Dr. Engs, professor of applied health and science, found that by increasing the legal drinking age, young people tend to abuse alcohol more. In actuality raising the drinking age was much worse than doing nothing. Drinking is more exciting when it is illegal. So many people go out and get drunk simply because they know that it’s illegal (Dr Engs). If we do away with this concept then we are left we people partaking in less booze filled nights. Leaving the decision of alcohol mostly to the family is the best scheme if the aim is to reduce underage drinking. We should also focus on safe drinking instead of age restrictions. Educating on the power of alcohol instead of just telling them not to drink it would create a better understanding for our young ones Other countries like France, have a much lower rate of alcohol abuse. This comes from educated and gradual drinking. American teens have not learned to drink gradually or in moderation. We need to focus on educating our young people on safe drinking and as a social activity, instead of a type of escape. Why is there still a problem if alcohol education currently exists? Because current alcohol education in high school and college teaches the following: This is how you drink responsibly, now don't drink because you are too young. How does anyone expect students to listen to a teacher when this gibberish is coming from their mouth? First you need to properly educate young adults. Second, you need trust them. If you treat young adults like children they will act like children. If you treat young adults as responsible adults they will act maturely. While most parents agree that serving alcohol to groups of minors should be prohibited, many also reserve the right to introduce their teenage children to alcohol. Supervised, moderate exposure to alcohol in the home with family lays the foundation for a healthy respect for alcohol and its associated responsibilities. Bryan Knowles) In conclusion, is 21 really the prestigious age we all can’t wait to reach. At 21, does all the maturity and intelligence we need to navigate this earth finally dawn on us! Well, our country seem to think so. So at the end of the day when you are deployed to Iraq to serve your country, don’t even think about having an adult beverage. Because you’re not an adult until 21, you must wait three more years. But look on the b right side, there will always be a beer waiting for you when you are of age.

Perspectives on Free-Speech Zones on College Campuses Essay

Naturally, many negative connotations come along with the term â€Å"free-speech zone. † The wording alone automatically insinuates that free speech should not be allowed everywhere, which is hardly the true intention of the idea. Sometimes the right of free speech is taken advantage of; such as in certain rallies and protests, where disruptive noise, violence, and destruction often occurs. Universities hold a responsibility to their students of providing a reasonably safe and undisruptive environment to learn and excel in. Universities are not creating â€Å"free-speech zones† to limit free speech, but rather to maintain a secure atmosphere that is conducive to concentration and higher learning. Universities should be able to maintain a certain level of safety on campus in whatever way they choose. â€Å"The University reserves the right to relocate or cancel the activity due to disruption from excessive noise levels, traffic entanglement, or if the safety of individuals is in question† (West Virginia University’s Student Handbook 91). They are not undermining the right of free speech that we as Americans legally hold, but are creating an appropriate means for demonstrators to voice their opinions without causing unnecessary disruption and chaos in inappropriate places on campus. An issue I do have with this idea of a â€Å"free-speech zone† is that there isn’t a clear definition of when or where these zones should be used. Who is to say whether or not the voicing of a certain opinion or idea requires the use of a â€Å"free-speech zone†? If what constitutes the use of a â€Å"free-speech zone† was better defined then the use of such â€Å"zones† could be more affective and appropriate. As stated by Robert J. Scott, protest zones have been used at many political conventions and other major events. â€Å"Protest zones can be reasonable restrictions that allow free-speech rights to be expressed while decreasing safety concerns and preventing undue disruption† (Scott 92). With the history of violence and destruction that is associated with protests, it is only natural that certain precautions be taken to prevent such problems. It is too vague to say the free expression of views or opinions may not â€Å"disrupt the normal function of the university,† as stated in the West Virginia University’s student handbook. Who decides what the â€Å"normal function† truly is, or when it is being â€Å"disrupted? † If a university decides to establish the use of â€Å"free-speech zones† then they should be able to provide a clear and concise description of when, and for what purpose, these â€Å"zones† should be used. One of a universities top priorities is to make their campus as safe and secure as possible, and if â€Å"free-speech zones† or â€Å"protest zones† are what they feel are necessary to maintain that security then they should be able to enforce them. The problem really comes down to whether or not these â€Å"zones† are used appropriately. If used extensively, and at levels that are unnecessary for the safety of students, then human rights issues could easily come into play. But if used in a smart way, such as for larger demonstrations of freedom of speech, like protests and rallies, then they could be helpful in preventing destruction and/or distraction on university campuses. â€Å"Requiring those expressing dissent to obey the law while doing so does not constitute repression† (Scott 92).

Consistency, parallelism and sentence variety are valuable techniques Essay

Consistency, parallelism and sentence variety are valuable techniques I have learned in this writing course - Essay Example consistent and concise essay, research paper, or other written document require special attention to be placed on the order of paragraphs and linking paragraphs. The order of paragraphs needs to be chronological with the importance emphasized with each sentence. Words and sentences should not be used unless they support the topic being discussed. Furthermore, to ensure consistency with the paragraphs more than the order is important, they also have to be linked. Linking paragraphs means keywords are repeated from one paragraph to another. It also means that transitional expressions and sentences are used. The thesis statement in this paper and topic sentence of this paragraph show how keywords can link one paragraph to another with a transition. Paragraphs are made up of words and sentences, which mean that sentence variety helps create a transition between the various thoughts in a paper through language awareness. Sentence variety means I need to use a mixture of long and short sentences to explain my idea. The words need to be concise, exact, fresh, and vary from the beginning. Discussing the use of words leads me to my next point with regards to parallelism. Parallelism requires the same tense, voice, person, number and tone to be used throughout a paper (Thurman, 2008). In a sentence I need to use the same verb tense. For example, washed, waxed, and vacuuming are not consistent. Washed and waxed are the same verb tense; however, vacuuming is a past progressive verb tense instead of past tense verb. Tone created by verbs and words in a sentence also needs to be consistent. Tone is considered the expression of the speaker (Abrams, 1999). If the tone changes the meaning of the paper may change or lead to confusion on behalf of the reader. Paragraphing techniques, parallelism, and sentence variety are the three main points I learned about in this writing course which all lead to a consistent and concise paper. I am able to take what lessons I learned from class

Feasibility Study Essay Example | Topics and Well Written Essays - 1500 words

Feasibility Study - Essay Example As a direct function of this, a litany of different programs and initiatives have been discussed and analyzed as a means of promoting health and healthful living to these young members of society. It has become painfully evident within the past several years that school programs alone art ineffective as a means of promoting such a change. In such a way, it is the belief and recommendation of this particular author that one of the most successful means by which a reduction in childhood obesity can be accomplished is with regards to utilizing many of the government owned and community operated playgrounds and parks as community centers that during key times of the week offer play activities, exercise, and help instruction to both parents and their children as a means of seeking to affect a positive influence upon the overall level of obesity that is noted within current society. Establishment of Feasibility: Ultimately, the low startup cost that is engendered with regards to the specif ic plan is one of the reasons that make it highly feasible for startup. Moreover, as the facilities already exist within the extant environment, it is not necessary for such a program to purchase and/or outfit a new or existing facility as a means of hosting such programs/courses (Landow & Ebdon, 2012). Furthermore, as has been mentioned briefly in the introduction, the overall need and demand for such programs has only increased as the overall incidence of childhood and adolescent obesity has subsequently increase within the environment. Accordingly, from a cursory overview of existing programs, both state and private, it can be inferred that a deficit in supply for such programs exists within the current market as compared to the demand. Naturally, the overall feasibility goes far beyond the place required to perform such programs and/or the level of interest that might be exhibited within the community (Liessmann, 1987). A litany of other startup costs and potential problems that must be face will be discussed in a certain level of length within the preceding sections. Competitor Analysis: One unique factor of the current market with regards to programs specifically targeting the exercise and health of adolescent to struggle with obesity is the fact that these almost invariably leverage government funding and operate as a public partnership. Although such a business model almost invariably defines the current market, it is the belief of this analysis that a public/private partnership could effectively leverage many of the existing strengths of current demand without necessarily reducing the overall level of demand that might be exhibited. Whereas the broad majority of these programs for public, private entities of also sought to engage with the need that is been reference; however, the degree and extent to which this unable to be accomplished has been limited due to the aforementioned limiting factors of purchasing a specific place and outfitting it to meet the needs of the stakeholders concerned. Financing One particular aspect of the public-private partnership that has been discussed above which will be beneficial is with regards to the issue of financing. Previous ventures into this field have noted that it is difficult if not impossible to achieve a level of sufficient funding based solely upon the

The Pillars of Policing Dissertation Example | Topics and Well Written Essays - 10000 words

The Pillars of Policing - Dissertation Example Through the use of the first pillar of helping to create a safe and secured environment the police department focuses on activities like tracking criminals, curbing criminal and vandalistic activities in the region and efficiently dealing with incidents of significant criticality. The second pillar of policing helps Sussex Police in making them better visible and approachable by the general public. Through this pillar the police department of Sussex endeavors to closely knit their activities with different communities to perform in a proactive manner. This practice also helps the police department to retrieve quality information and responses from the people which thereby helps them in curbing crimes. The third pillar is used by the police force to make efficient and optimal use of the human and financial resources of the police organization to effectively track down the criminal operations of the region. (Three Pillars, n.d.). The police force of Scotland operates on the basis of fi ve basic principles to promote a safer region for the citizens to dwell in. These operational principles or the pillars of Scotland police consist of acts like safeguarding the society from criminal activities, breaking the network of drug trafficking, reassuring the general people that they are safe through the conducting of patrolling operations, prioritizing the safety of the road environment for the driving and daily commuters, and finally helping the police force to become increasingly advanced and trained to handle complexities. (Central Scotland Police, n.d.). Similarly the community policing activities of United Kingdom are also based on eight operational pillars which can be enumerated as follows. The first operational pillar of community policing is to reduce the rate of criminal activities and the rate of disorderliness in the region. Secondly the actions of the police must be conducted of, by and for the general public and not for the sake of meeting operational guidelin es. Public approval for police operations is highly essential for reducing the former’s conflicts with the administration. Thirdly following the above context the police administration of a region must reflect a high amount of honor for the citizens of a country in desiring them to abide by the rule of the land. Fourthly the police administration of a country must endeavor to minimize the use force on making the people abide by the rules of the land physical torture affects the cooperative mechanism of the society with the administration. The fifth operational pillar of community policing states however justifies the use of force when all other arbitration mechanisms fail to reduce public tension. Sixthly more specifically the police system in the society must visualize itself as a key force in restoring safety and harmony in the community and thus be socially accountable. Seventhly the operational pillar also holds that the police system must not augment its potential throug h judicial involvement but must depend on its own actions. Finally in the eighth position the operational pillar holds that measurement of true efficiency of the police force is done on by observing the rate of absence of crime and social disorder and not merely the police’s actions related to such. (Special Feature: Historical Perspective, n.d.). The paper in this context draws a comparison of the police actions of United Kingdom with that of United States. The Police system in United

SOCIAL WORK IS PAPER TOPIC----Analysis of Assessment and Intervention Assignment

SOCIAL WORK IS PAPER TOPIC----Analysis of Assessment and Intervention Skills with Families(paper topic) - Assignment Example By evaluating the narration, the therapist connects these stories with the client’s life experiences and can recognize the links between different situations. In this narrative theoretical frame work, the therapist categorizes the experience into â€Å"dominant† stories and â€Å"alternative† stories (Allyn & Bacon, 1998, p.2). Structural frame work of family â€Å"indicates† the relationship and role of every individual in a family. The quality of a family depends on the â€Å"cohesive† attitude and â€Å"flexibility† of its members and the bonding among them (Allyn & Bacon, 1998, p.2, 4). A family structure includes certain â€Å"boundaries† which relating to the participation of members in family. In narrative therapy, the philosophy and approach is to focus on individual values of the client, within the family context. On the other the structural approach relies on the structure of the family rather than the individual traits of the client. The â€Å"alignment† features of family structure contains the same interests of the members and involvement of two family members to third member and the â€Å"power† of a family structure revolves around the head the family and his or her influence on the final output of a family activity (Allyn & Bacon, 1998, p.4). The structural theoretical frame work of family therapy regulates the involvement of every family member. The â€Å"explicit† and the â€Å"implicit â€Å"contract and the client centered approaches of the therapy differentiate it from narrative theoretical frame work of family therapy (Allyn & Bacon, 1998, p.4). In narrative frame work, the clients get a chance to â€Å"re-author† their stories , and through this re-telling the clients will come to know about themselves (Allyn & Bacon, 1998, p.1). The idea of reframing is a concept where the therapist asks same questions to two members of the same family. This is intended to derive different perspectives of an issue in hand so

Topic Of Choice Essay Example | Topics and Well Written Essays - 500 words

Topic Of Choice - Essay Example It is particularly the case of US traffic situation. How serious is the problem of traffic congestion? This is a question that has almost been neglected for an enquiry. Or people are just careless about public matters in the blind pursuit of personal interests and comforts. However, as the USA Today reports, â€Å"The nations traffic problems are getting worse faster than they can be fixed — even in small cities such as Brownsville, Texas, and Pensacola, Fla.† (Traffic problems take big bite of commuters time. 2004). The problem of congestion is more severe in urban areas and factors like the design of the area, geographic features, weather, collisions and vehicle breakdowns and many such, cause this problem. There are, of course, solutions that may effectively solve this. First of all, the allotment of funds is not sufficient to take the necessary action. Even the allotted fund is not efficiently managed, i.e. it is not used on priority basis. The development of highways and transit systems is not in accordance with the problem of congestion. The capacity expansion of the existing roads and construction of new roads are of prime importance. Public transportation improvement projects would enable more productivity from the existing ones, thus working as a solution. Greater efficiency of the transportation system can help a lot in this regard. More efficient alternate systems must be aimed at, thus encouraging the public reduce the traffic congestion. The transport system needs to be better managed to make the public use more of the public transportation system rather than individual vehicles. The more the public transportation used, the lesser the traffic congestion will be. Public transportation at peak hours should be becomes the most significant reason for the traffic congestion is the increasing number of private vehicles. â€Å"So, the most important solution to the problem of traffic congestion is the

Self-Sacrifice in O.Henry's Gift of the magi and Rabindranath Tagore's Essay

Self-Sacrifice in O.Henry's Gift of the magi and Rabindranath Tagore's The Cabuliwallah - Essay Example O’Henry was praised as a valued US Southern writer who recorded the reality of the south of his time in his stories. His personal history is almost as interesting as those of his characters, and nearly as ironic, While many know his real name, few know his real history, since fact and fiction have become totally entwined, and the "legendary O. Henry †¦ is very different from the real William Sydney Porter. In his bit of autobiographica, which he published in the New York Times, April 4, 1909, Porter himself contributed to this legend." (Paine 351) Writing was probably a very good career for OHenry at that time, because he spent more than three years in prison for a crime he did not commit, and he was reclusive type in any case. It is not that he never went out, but he seldom revealed anything terribly personal about himself("Federico and the Magis Gift." 70-70). He is known for the interesting twists in his stories, the most famous of which is probably The Gift of the Magi. In the story a young couple were very poor each sacrifices their most precious possession in order to buy a beautiful gift for the other. The poignant irony is that each gift it is bought to accompany the precious thing that the other sacrificed. In the wifes case she had her long hair cut in order to buy a beautiful platinum watch fob for her husbands gold watch. The husband, in his turn, sold his gold watch to buy her some very expensive combs for her hair. I was found it rather sad that he actually sold the watch. I wouldve preferred that he pointed, since it was a family heirloom. Her hair will grow back, and they pawned watch could be redeemed. Rabindranath Tagore was born into a privileged family in 1871 and died in 1941 before the final split up of India. He was a fierce nationalilst, but was known to criticize Gandhi for being a bit too extreme. He did not

Success is about hard work and not luck Essay Example for Free

Success is about hard work and not luck Essay This is the case of 74 year old male patient heavy smoker (2 packs per day) presenting to the floor of MGH for the above chief complaints. History goes back to 15 days when the patient noticed 3 successive episodes of blood with urination at morning, one hour apart, painless ,of large amount, complete stream ,also the patient recorded that he saw 2 pieces of clots after voiding at noon of same day .then the color of urine was back to normal as the patient said. there’s associated nocturia, urgency, and drippling of one month duration .also weight loss of 15 kg within 3Â  months.NO burning sensation , no pain ,no dysuria, no fever ,no flank pain,no back pain, no nausea no vomiting, no constipation ,no other system involved symptoms. The patient was admitted to MGH for further investigations. PMH : DM 25 years ago HTN 10 years ago CAD 10 years ago Medications: concor 5 mg one at morning aspicot 100 mg OD Lipitor 20 mg OD glucophage 750 mg PO BID amaryl 4 mg PO daily tritase 10 mg PO daily PSH: CABG, hemorroidectomy , left herniectomy, right hip fixation by plates and screws(duration unknown by the patient). Family history: Mother(DM,HTN,CAD) Allergy : No known drug or food allergy. Physical examination: General examination: The patient is conscious, cooperative, oriented, pale, sitting, thin , cachectic ,having foley catheter.(seen 2 days postop) Vital Signs: RR: 24/min Pulse: 64/min Temp.: 37.4 C BP: 160/90 mmhg. HEENT : pallor, no cyanosis, no jaundice, no ecchymosis, no mouth ulcers , bad oral hygiene Decreased visual acuity (presbiopia) ,arcus senilis ,diplopia No tinnitus, no vertigo (Dix hallpike test not done) Chest ex:good bilateral air entry. No rub, no crepitations, no wheezes. cardiac ex: Regular S1S2 with no murmurs. Abdomen ex: 1. Inspection: non distended symmetrical abdomen No visible pulsation or peristalsis No localized bulge Male pattern of hair distribution Umbilicus is slightly shifted downwards, no discharge No full flanks Normal subcostal angle No spider angiomas No visible veins No scars, or scaling red colored urine(in the foley’s bag) but the urine is clear due to irrigation of bladder 2.Auscultation: audible bowel sounds, no renal artery bruit 3.Palpation: soft non tender abdomen, warm, no palpable masses, Lower border of liver is not felt, upper border at 5th ICS along the MCL Spleen is not palpable Both kidneys are not palpable , no CVA tenderness. no suprapubic pain. 4.Percussion:tympanitic urinary bladder 5.DRE: not done 6.Genitalia examination: not done Lower limbs :positive pedal pulses no lower limb edema, no redness no bruises no muscular atrophy. Differential diagnosis: 1- bladder cancer 2- BPH 3- Prostatitis 4- Urolithiasis 5- Prostate cancer incidental or advanced. Investigations : Labs : CBCD, BUN, Creatinine ,electrolytes, CRP, HBA1C,FBS,LDL,HDL,triglyceride PT ,PTT ,PSA, urine analysis and culture. Imaging : CT urography(uroscan),cystoscope and urine cytology. What was done at the hospital : Item Minumum Maximum Value pre op Hemoglobin Urine analysis : normal Ultrasound of pelvis : no post residue voiding ,small thick wall, prostate is enlarged measuring 39 grams Management : Control the glucose level preop TURBT TURP to relieve obstruction with biopsy of prostate Send the samples to pathology and wait the results. If the tumor did not invade the detrusor muscle it’s superficial and managed according to grading and depth (Ta low grade TUPBT only ,T1 low grade or Ta high grade TURBT + intravesicle injection of chemotherapy , T1 high grade TUPBT and relook after 1 month) if invade the detrusor muscle : T2 = metastatic workup CT abdomen ,chest , and bone scan.then remove the bladder and do urinary divergence by neobladder or ileostomy(conduit).

DI-MS Technique for Analyzing Protein and Peptide Sequences

DI-MS Technique for Analyzing Protein and Peptide Sequences Food Industrial Application DI-MS technique has been widely applied in food industry as it is an easy and high-throughput tool for analyzing protein and peptide sequences, studying the components or structure in food, monitoring the contamination in food. FAB-MS In the study by Terzi, Boyot, Dorsselear, Luu and Trifilieff (1990), the amino acid sequence of a new 6.8 kDa proteolipid from beef heart was determined by employed FAB-MS. The study isolated and purified the 6.8 kDa proteolipid from an acidic methanol/chloroform extract of bovine cardiac muscle, and subsequently analyzed it with the application Cs atom beam of FAB-MS in 1-thioglycerol matrix. The result showed a protonated molecular ion [M+H]+ at m/z 6834.1 and indicated that it have about 60 residues. The 60 residues in the polypeptide were cleaved into three peptide fragments CN1, CN2 and CN3. To characterize these cleavage peptides from amino acid composition, the CN1 and CN2 were ionized using the FAB-MS that performed with Xe atom beam and 1-thioglycerol matrix while the CN3 which also dissolved in 1-thioglycerol was collided by Cs atom beam to produce sample ions. Table 1.0: Chemical mass of cleavage peptides Cleavage peptides Measured mass [M+H]+ [M+Na]+ CN1 1539.0 1560.9 CN2 2100.5 2121.8 CN3 3134.6 From the analysis of the cleavage peptides, the amino acid sequence and peptide fragments of the 6.8 kDa proteolipid were reported as: MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASS 1 CN1 13 14 CN2 31 32 CN3 AAPAHGHH 60 In addition, the FAB-MS technique was applied to determine the structure of the Lycium chinense Miller fruits (Gou-Qi-Zi) in combination with NMR and IR spectroscopy (Chung, Ali, Praveen, Yu, Kim, Ahmad, 2014). L. chinense fruit is a valuable tonic or food, hence there are many researches have been reported to display the properties the L.chinense fruit. For example, the anticancer, antibacterial and antioxidant properties (Lee et al., 2005; Wang, Chang, Inbaraj. Chen, 2010; Zhang et al., 2011) and the antihepatotoxic activity and chemical constituents (Chin et al., 2003; Kim et al., 1997). In the research, the four new compounds (i, ii, iii and iv) that isolated from L. chinense fruits were characterized using the FAB-MS (JMS-700) spectrometer. The antioxidant activity of the four compounds was further studied and it demonstrated that the activity of the compounds followed the order 1423. Table 2.0: Characterization of compound (i) to (iv) Mass Species m/z Detected species Suggestion Compound (i) [M+H]+ 817 C40H65O17 -aromatic acid glycosidic ester 283 [CH3(CH2)16COO]+ -steric acid was esterified with one phenolic group 267 [CH3(CH2)16CO]+ 414 [C15H26O13]+ -three arabinose units bind to one phenolic group 265 [C10H17O8]+ 133 [C5H9O4]+ Compound (ii) [M+H]+ 1165 C50H85O30 -susquiterpene glycoside ester 265 [C10H17O8]+ -few arabinose units bind to the sesquiterpene moiety 223 [C14H27CO]+ 133 [C5H8O5]+ Compound (iii) [M]+ 1309 C58H100O32 -hexaglycoside 341 [C12H21O11]+ -six hexose sugar units bind to each other -unsaturated fatty acid located at terminal position 335 [C21H39COO]+ 325 [C12H21O10]+ 319 [C12H39CO]+ 179 [C6H11O6]+ 163 [C6H11O5]+ Compound (iv) [M+H]+ 841 C31H52O26 -five arabinose units and one glucose unit 661 [C25H41O20]+ -five pentose sugar units bind to a hexose sugar 529 [C25H41O20-C5H8O4]+ 281 [C10H17O9]+ TOF-SIMS TOF-SIMS which widely applied in surface analysis is an important technique for monitoring the contamination in food as the usage of pesticides and fungicide in the agriculture practice will alter and compromise the food quality. The study used TOF-SIMS technique to characterize and compare three different groups of Seggianese olives which classified as untreated (UT), treated with insecticide (dimethoate) and fungicide (copper oxychloride) without washing (TU) and treated with insecticide and fungicide with washing with cold water (TW) (Focardi, et al., 2006). Before measuring the molecular masses of three different groups of olives, the mass calibration was done by using CH3+, C2H3+ and C3H5+ peaks as calibration compounds for positive ions C, CH and C2H peaks as calibration compounds for negative ions. The SIMS data proved the chemical treatments modify the surface composition of olive, resulting in higher intensity signals in TU compared with TW or UT olive spectra. Besides, the intensity of UT and TW olives showed a small variance between each other, demonstrating the washing process was no effective in removing of insecticides and fungicides that will stimulate the composition alterations of olives. Table 3.0: Intensity of few relevant peaks from three different olive samples Peaks Mass peak m/z Attribution Intensity TU olive TW olive UT olive Positive 31.018 CH3O+ 4.23 10-4 6.93 10-5 1.12 10-4 57.074 C4H9+ 1.18 10-2 5.92 10-3 5.08 10-3 73.051 C4H9O+ 7.83 10-4 3.34 10-4 3.08 10-4 147.082 C6H14NOP+ / C6H13NOS+ 2.42 10-4 7.37 10-5 2.93 10-5 Negative 15.994 O 1.13 10-4 2.30 10-3 7.20 10-3 17.002 OH 1.19 10-4 4.42 10-3 5.44 10-3 31.972 S 5.24 10-4 1.99 10-5 1.47 10-5 MALDI-TOF/TOF MS MALDI-MS is a widespread analytical tool for proteins, peptides and oligonucleotides as it offers high ion yields of the intact analyte samples, high sensitivity and accuracy (Lewis, Wei, Siuzdak, 2000). In year 2012, a research about the peptide of peanut hydrolysate has the properties of umami taste had reported by Su, Cui, Zheng, Yang, Ren Zhao. Umami taste is known as the fifth basic taste and it usually described as savory or MSG-like taste. In the study, two novel umami and umami-enhancing peptides were isolated from peanut hydrolysate, purified using chromatography and identified by MALDI-TOF/TOF MS. The analysis of peptides was performed by MALDI-MS equipped with 337nm of UV nitrogen laser and matrix solution as sinapic acid saturated in 0.1% trifluoroacetic acid and acetonitrile. The MALDI-TOF/TOF MS was used to sequence the two novel peptides that termed as P3 and P4 as they produce umami taste. It found that the molecular mass of P3 and P4 was 1091.419 Da and 965.595 Da respectively and the amino sequence of P3 is EGSEAPDGSSR while P4 is SSRDEQSR. Bibliography Chung, I. M., Ali, M., Praveen, N., Yu, B. R., Kim, S. H., Ahmad, A. (2014). New polyglucopyranosyl and polyarabinopyranosyl of fatty acid derivatives from the fruits of Lycium chinense and its antioxidant activity. Food Chemistry, 435-443. Focardi, S., Ristori, S., Mazzuoli, S., Tognazzi, A., Leach-Scampavia, D., Castner, D. G., et al. (2006). ToF-SIMS and PCA studies of Seggianese olives and olive oil. Colloids and Surfaces, 225-232. Lewis, J. K., Wei, J., Siuzdak, G. (2000). Matrix-assited laser desorption/iomization mass spectrometry in peptide and protein analysis. Chichester: John Wiley Sons Ltd. Su, G., Cui, C., Zheng, L., Yang, B., Ren, J., Zhao, M. (2012). Isolation and identification of two novel umami and umami-enhancing peptides from peanut hydrolysate by consecutive chromatography and MALDI-TOF/TOF MS. Food Chemistry, 479-485. Terzi, E., Boyot, P., Dorsselear, A. V., Luu, B., Trifilieff, E. (1990). Isolation and amino acid sequence of a novel 6.8-kDa mitochondrial proteolipid from beef heart. FABS Letters, 122-126. Conclusion In food industry, the analysis of protein and peptide can be performed well by using MALDI-MS and FAB-MS while the application of SIMS is mostly used for detecting the surface of contaminated food. Besides, the structure of the components in foods can also be identified by using the FAB-MS combined with NMR and IR spectroscopies.

Pinpoint Colluding Attackers for Software-as-a-Service Cloud

Pinpoint Colluding Attackers for Software-as-a-Service Cloud Abstract- Software as a Service (SaaS) is a distribution model of software in which service provider or vendor develops applications and these are accessible by the customers over a network. SaaS clouds are vulnerable to malicious attacks because of their sharing nature. IntTest, service integrity attestation framework has been anticipated and it uses a novel integrated attestation graph analysis scheme to pinpoint attackers. But IntTest has still a limitation that attackers can still escape the detection if they have less inconsistency links than benign service providers. In this paper, we present Function Combination Generator along with the IntTest in order to detect the attackers more in number. Also, Result Auto Correction is provided to correct the incorrect results provided by the attackers. Our experimental results shows that our scheme is effective and can achieve higher accuracy in pinpointing the attackers more in number than the existing approaches. Index Terms- Cloud Computing, Integrity Attestation, Multitenant, SaaS, Function Combination Generator 1 INTRODUCTION Cloud computing depends on resource sharing over a network. Cloud computing mainly relies on improving the efficiency of shared resources. Cloud provides services like Software as a Service (SaaS), Infrastructure as a Service (IaaS), and Platform as a Service (PaaS). This paper mainly deals with Software-as-a-service. Software as a Service depicts any cloud service where providers deploy their applications and consumers use those applications through a client interface such as web browser. Software as a Service and Service Oriented Architecture (SOA) [4] provides certain concepts for the evolution of Software as a Service clouds [1] (e.g., Amazon Web Service (AWS) [2] and Google App Engine [3]). SaaS clouds provide a way for application service providers (ASPs)[5], [6] to transport their applications through the huge cloud computing infrastructure [7]. Figure 1 shows the origin of Software as a Service deployed on either public, private or hybrid cloud and its relation with the end u ser. As ASPs from different security domains shares Cloud Computing infrastructures, they are vulnerable to attacks. As Cloud Computing attracts many providers due to its cost-effective concept, it has become very popular at recent. This paper concentrates on service integrity attacks on SaaS clouds. The user gets the bad results due to these integrity attacks when requested for a service. Figure 2 shows the integrity attacks in SaaS clouds. Multitenant architecture is one that is responsible for most of the SaaS cloud solutions. In the previous research, only privacy protection and confidentiality problems have been widely stated, but the service integrity attestation was not clearly addressed. Service integrity is one of the main problems that need to be solved despite whether the public or private clouds process the data. Various researchers have presented certain service integrity attestation schemes but the problem is that they require secure kernel or trusted hardware support. Because of these problems, Multitenant cloud computing does not carry those schemes. Later, Juan Du has proposed IntT est, an efficient framework for large scale cloud systems. A novel integrated attestation graph analysis scheme has been provided by the IntTest that detects the attackers more when compared to the existing schemes. But the problem here is that the attackers can still escape the detection if they have less inconsistency links than benign service providers. i.e., If only one order of service functions is given by the providers for a service, the attacker acts as genuine and colludes with other attackers and provides fake results. With this, all the inconsistent results caused by the attackers are not detected completely and the fake results are assumed as good one and provided to the users. With this, we can say that that IntTest cannot detect the colluding attackers. In this Paper, Function Combination Generator is provided for the IntTest to overcome the limitation. Function Combination Generator along with IntTest can attain more attacker identifying accuracy than existing schemes like Run Test and AdapTest. In particular, AdapTest and RunTest with the other conventional voting schemes wants to believe that benevolent service providers take bulk in every service function. Figure 1: Software-as-a Service To make the targeted service functions as malicious, several attackers may launch on colluding attacks in large scale multitenant cloud systems. In order to overcome this problem, IntTest with FCG adopts a systematic method by exploring the both consistency and inconsistency relationships between various service providers in the whole cloud system. The per-function consistency graphs and global inconsistency graphs have been validated by the IntTest. The attackers can be detected more effectively, it does not allow the attackers to escape as well as reduces the scope of damage caused by the attackers by using Function Combination Generator with IntTest. With the scalable IntTest along with Function Combination Generator, the burden provided with attestation can be reduced to an extent than any other schemes. This paper provides the below implementations: IntTest, an efficient and scalable service integrity attestation framework for broad cloud computing infrastructures. Function Combination Generator that generates different set of orders for a particular set of functions for the given service. Baseline and Integrated attestation schemes that attains more attackers pinpointing than the existing schemes. Result auto correction method that eventually replaces the fake results provided by the colluding attackers with the correct results. The rest of this paper is organized as follows. Section 2 presents the related work. Section 3 presents the proposed Work in detail. Section 4 presents the design. Finally, the paper concludes in section 5. Figure 2: Integrity attacks in cloud based data processing Where, Sn= different service components n= {1, 2, 3, 4, 5, 6, 7} VM= Virtual Machines 2 RELATED WORK SaaS clouds are given with various integrity attestation schemes in recent years. The BIND scheme, TEAS, RunTest and AdapTest are some of the schemes but these in turn have some issues that are to be dealt with. Some of them want trusted hardware and support of secure kernel. BIND [10] (Binding Information and Data) is one that requires secure kernel or a third party support. To verify the service integrity for SaaS clouds, BIND exhibits the fine grained attestation framework. This BIND scheme follows these steps. 1) Attestation annotation mechanism. 2) Sandbox mechanism. 3) Verification of authenticator through hash. In order to address the service integrity attestation, Diffee-Hellman key has been used by the BIND scheme. TEAS [11] (Timed Executable Agent System) is another provided scheme that address the integrity for SaaS clouds. It uses Agent generation and verification algorithm. But the problem is that it is not scalable and does require trusted hardware. RunTest [8] has been proposed later with further corrections. RunTest, a scalable runtime integrity attestation framework attains the data flow processing integrity in cloud. It promotes light-weight application level attestation mechanism. With this, it identifies the attackers when inconsistent results are detected and also integrity of data processing results is examined. This RunTest gives the information on who are benign service providers and also the attackers’ stealthy behaviour. The disadvantage that RunTest has is its low performance. The AdapTest [9] is another existing scheme that presents a novel adaptive data driven runtime service integrity attestation framework to verify the service integrity in SaaS clouds. It reduces the detection delay and also the attestation overhead. It treats all the service components as black boxes so any special hardware support is not needed by the AdapTest. The disadvantage is that detection rate is low. So later, to overcome all th e limitations of the existing schemes, IntTest has been proposed. Any secure kernel or hardware support is not needed by IntTest as it also treats the components as black boxes. IntTest provides more detecting accuracy than above all the existing schemes. But still the IntTest has a limitation that attackers try to escape the detection by colluding with the other attackers. So, we proposed Function Combination Generator technique to be used with IntTest to overcome the limitation. With this Function Combination Generator with IntTest, there is no chance for the attackers to escape. 3 PROPOSED WORK Software as a Service clouds are evolved from the basic concepts of Software as a Service and Service Oriented Architecture. It provides a way for the application service providers to build their applications and transport them through cloud computing infrastructure. Here, we are proposing a new technique called Function Combination Generator for IntTest. To pinpoint all the colluding attackers is the main goal of IntTest with Function Combination Generator. And it should not make attackers to escape from detection. Various service providers are negotiated by a single attacker in multitenant cloud systems. Here, certain assumptions are made by the IntTest. First, in the entire cloud system the total number of benign service providers is greater than the malicious service providers. Without this assumption, the IntTest scheme does not work properly. Second, the data processing services are input deterministic. Whatever input is given by the benign service component, it should produce the similar output. Third, the hardware and software faults that grounds the result inconsistency are marked by fault detection schemes [12] and can be removed them as malicious attacks. Figure 3 depicts the overall architecture of our proposed work. The architecture flows like this. At first the user requests the cloud for a particular service, and that requested service is deployed in the cloud and promotes that request to SaaS. SaaS cloud process the request and generates the result to the cloud. Next, Function Combination Generator regulates different set of orders for service functions and then IntTest checks the consistency and inconsistency relationships and then identify the malicious attackers. Result autocorrection corrects the bad results produced by the attackers and stores the corrected data and finally corresponding good results are sent to the user. Figure 3: Architecture 4 DESIGN In this section we present the design of the proposed system. First, we present the Function Combination Generator. We then describe baseline and integrated attestation schemes and next, we present the result autocorrection scheme. 4.1 Function Combination Generator Service is one that consists of several components that in turn consists of different number of functions. Service may contain any number of functions like f1, f2, f3, f4 etc. When the SaaS cloud generates the service as per requested by the user, then the Function Combination Generator generates different set of patterns for the functions such as f1, f3, f2, f4 and f2, f3, f4, f1 and soon. By generating like this, there we can see that the attackers can’t escape from detection. Function Combination Generator is an efficient technique provided with the IntTest to detect the colluding attackers in large number. 4.2 Baseline Attestation Scheme IntTest is mainly used to detect the service integrity attack in SaaS clouds and also pinpoint malicious service providers. In Cloud Computing, several providers develop the same function as they are popular. Function Combination Generator after generating patterns sends the results to the IntTest. IntTest then obtains the consistency and inconsistency relationships among the different service providers for a particular set of service function generated. Figure 4 depicts the consistency check mechanism. As shown in the figure 4, the service providers are p1, p2 and p3. The same function f is developed by all the providers. Portal node is one that has global information like number of ASPs etc., It acts as a gateway to use the services. Provider p1 first receives the original data input p1 from the portal node and generates the result f(d1). Again provider p3 receives the duplicate of d1 and generates the result f(d1’). Next the relationship between the providers is derived. If both the providers generate the same result, they are said to be consistent with each other. If not they are inconsistent with each other, then we can say that one of them is malicious. Like this, we derive the relationships among various service providers. Figure 4: Consistency Check 4.3 Integrated Attestation Scheme Now, an integrated attestation graph analysis algorithm is given here. Step 1: Consistency analysis: Based on the consistency relationships derived by the Baseline attestation scheme, we derive per-function consistency graph as shown in figure 4(a).. With this, the distrustful service providers can be identified. The consistency graph presents certain consistency links among a set of service providers. Those service providers give same results for every specific service function. Like if service providers p1, p2 give consistent results for a function f1, they give the same consistent results for all functions like f2, f3, f4 and so on. The benign service providers who give consistent results for a particular function will form a clique in terms of consistency links. With this per-function consistency graph, we cannot clearly identify who the attacker is. So, we must also consider inconsistency graph too. Figure 4: Attestation Graphs Step 2: Inconsistency analysis: The global inconsistency graph as shown in figure 4(b) is derived from the inconsistency relationships drawn by Baseline attestation scheme. This graph contains only inconsistency links, there may involve various possible combinations of benign node set and malicious node set. Here, we have to believe that total number of malicious service providers is not greater than max number of malicious service. Function Combination Generator generated different set of patterns for a particular service. By generating like this, there is no chance for the attackers to escape as they give inconsistent results with all the patterns when consistency check is done. If any provider gives only incorrect results with all the patterns, we confirm that provider as a corrupted one. Like this, we will find the attackers more in number. 4.4 Result Auto Correction To regularly correct the bad results provided by the attackers, Result Autocorrection is provided. IntTest with Function Combination Generator can not only pinpoint malicious service providers and even autocorrects the bad results with good results and thus improving the result quality of the cloud data processing service. With the absence of attestation scheme, any malicious attacker can change original input data and with this the processing result of that input will be corrupted which will result in degraded result quality. IntTest presents attestation data and correct compromised data processing results. Function Combination Generator given with IntTest, it can achieve higher detection accuracy than any other techniques when malicious service providers attack more nodes. This method will identify the attackers even though they attack a very low percentage of services. This technique can achieve higher detection rate than any other existing scheme and will have low false alarm rate than others. Comparison Study Below is the table that compares various parameters like detection rate, time and attestation overhead among various approaches like AdapTest, RunTest, and IntTest with no Function Combination Generator and IntTest with Function Combination Generator. 5 CONCLUSION In this paper we introduced a technique called Function Combination Generator for IntTest, a novel integrated service integrity attestation graph analysis scheme for multitenant software-as-a-service cloud system. Function Combination Generator generates diffsaerent set of patterns for service functions and then IntTest uses a reply based consistency check to verify the service providers. IntTest with Function Combination Generator analyses both the consistency and inconsistency graphs to find the malicious attackers efficiently than any other existing techniques. And also it provides a result auto correction to improve result quality.

The Atom Bomb :: essays research papers fc

The atom bomb is one of the most important discoveries in modern day science. Countless scientists worked relentlessly on the project and their efforts opened the door for present and future exploration of the atom.Just before the beginning of World War II, Albert Einstein wrote a letter to President Franklin D. Roosevelt. Urged by Hungarian-born physicists Leo Szilard, Eugene Wingner, and Edward Teller, Einstein told Roosevelt about Nazi German efforts to purify Uranium-235 which might be used to build an atomic bomb. Shortly after that the United States Government began work on the Manhattan Project. The Manhattan Project was the code name for the United States effort to develop the atomic bomb before the Germans did. "The first successful experiments in splitting a uranium atom had been carried out in the autumn of 1938 at the Kaiser Wilhelm Institute in Berlin" Just after Einstein wrote his letter. So the race was on. Major General Wilhelm D. Styer called the Manhattan Project "the most important job in the war . . . an all-out effort to build an atomic bomb." It turned out to be the biggest development in warfare and science's biggest development this century.The most complicated issue to be addressed by the scientists working on the Manhattan Project was the production of ample amounts of enriched uranium to sustain a chain reaction. At the time, Uranium-235 was hard to extract. Of the Uranium ore mined, only about 1/500th of it ended up as Uranium metal. The Uranium metal is relatively rare, occurring in Uranium at a ratio of 1 to 139.Separating the one part Uranium-235 proved to be a challenge. No ordinary chemical extraction could separate the two isotopes. Only mechanical methods could effectively separate U-235 from U-238. Scientists at Columbia University solved this difficult problem.A massive enrichment plant was built at Oak Ridge, Tennessee. H. C. Urey and his associates and colleagues at Columbia University designed a system that worked on the principle of gaseous diffusion. After this process was completed, Ernest O. Lawrence from the university of California in Berkeley implemented a process i nvolving magnetic separation of the two isotopes. Finally, a gas centrifuge was used to further separate the Uranium-235 from the Uranium-238. The Uranium-238 is forced to the bottom because it had more mass than the Uranium-235. This Uranium was then transported to a laboratory headed by J. Robert Oppenheimer. Oppenheimer was the major force behind the Manhattan Project.

Essay --

Introduction Participation in sports for children and youth is ever growing and there have been many benefits associated with it, including self-confidence and self-esteem, social and life skills development and improving mental and physical health. (Allender et al., 2006; Coplan & Findlay 2008; Donaldson and Ronan, 2006) Apart from these benefits, advocates of sport participation believe that sports provide the appropriate context for social and life development skills, which brings about the idea of character development through sports participation. (Weiss, Smith, & Stuntz, 2008). Life skills as suggested by The World Health Organization (1999), play a very important role in the healthy development of adolescents, as it helps prepare them for their future. The use of sports to help with such development is further supported by sport psychologists whom have argued that life skills can be taught in combination with athletic skills in sport contexts (Danish & Nellen, 1997). Sports has been thought to be a platform whereby children and youth are able to learn and cooperate with their teammates, develop self-control, display courage and leadership, communicate and form solutions to internal or external group conflicts and the learning of good virtues such as teamwork, fairness and good work ethics. (Shields & Bredemeier, 1995; Weiss & Bredemeier, 1990). Many parents therefore encourage and enroll their children into sports in hope that they will be able to learn and pick up these positive character-related values and behaviour. On the other hand, there have been other studies to argue the fact that sports instead of developing character, it undermines character. (Bredemeier, 1985, 1994; Bredemeier, Weiss, Shields, & Shewchuk, 198... ...certain behaviours which they interpret as being able to gain praises from their coach. As such, the way in which coaches verbalise, comment and teach the rules of the game to their players, will ultimately determine the way in which the players will interpret and act upon the rules during game play. (Bar et al., 1989) With the increasing number of primary school students taking part in sports, sport can present itself as a great platform for character development; but the positive outcomes are not always guaranteed. A coach who is able to capitalise on this invaluable and unique platform to inculcate good values is essential in order to ensure positive character development outcomes. This study aimed to describe and analyse a successful primary school netball coach's experiences, strategies and the desired outcomes for athletes as a function of her coaching.